If you have been reading about Adsorption and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Storage at minus 20 degrees Celsius or lower in a desiccated container preserves the peptide for extended periods, while working solutions are commonly held at two to eight degrees Celsius for short intervals. Light exposure and repeated freeze-thaw cycles accelerate degradation, so dividing material into single-use aliquots is generally recommended. Adsorption to glass and plastic surfaces can lower the measured concentration of dilute solutions, particularly below one milligram per millilitre. The degradation routes most often reported for GLP-1 analogues are deamidation, methionine oxidation, and backbone hydrolysis. Relative rates under specific conditions are frequently described only for individual formulations.
Reverse-phase high-performance liquid chromatography with ultraviolet detection near 214 or 280 nanometres is widely used to assess purity and to resolve related impurities. Liquid chromatography coupled to mass spectrometry confirms identity through the protonated molecular ion and fragment ions formed in tandem experiments. Capillary electrophoresis and peptide mapping after enzymatic digestion supply complementary information on charge variants and modification sites. Circular dichroism and nuclear magnetic resonance can report on secondary structure in solution. Absolute quantification usually depends on an external standard, and reported purity depends on the detection wavelength and integration parameters chosen.
Development began in the early 2010s with the goal of extending GLP-1 activity beyond the brief window achieved by native peptide infusion. The earliest approved formulation was a subcutaneous injection given once weekly. A later oral tablet pairs the peptide with an absorption enhancer, sodium N-(8-[2-hydroxybenzoyl] amino) caprylate, usually shortened to SNAC. That carrier lowers local pH and helps the peptide cross gastric tissue. Both routes deliver the same active molecule.
Semaglutide is a synthetic peptide analog of human glucagon-like peptide-1, a gut hormone released after meals. Its backbone retains the GLP-1 sequence but incorporates two substitutions that slow enzymatic breakdown by dipeptidyl peptidase-4. A short polyethylene glycol linker and a C18 fatty diacid are attached to the peptide chain, allowing the molecule to bind serum albumin and remain in circulation far longer than the native hormone. The result is a circulating half-life measured in days rather than the minutes typical of endogenous GLP-1.
| Property | Value | Notes |
|---|---|---|
| Purity assessment | RP-HPLC, 214 nm | Wavelength affects relative peak areas |
| Identity confirmation | LC-MS/MS | Precursor and fragment ion masses compared |
| Common degradation | Deamidation, oxidation | Amide and methionine residues are main sites |
| Working solution storage | 2-8 °C, short term | Longer holding favours frozen aliquots |
| Adsorption risk | Higher below 1 mg/mL | Glass and plastic surfaces both affected |
Stability studies examine how temperature, pH, and moisture influence degradation rates over time. In aqueous solution, hydrolysis and deamidation accelerate as pH moves away from mildly acidic conditions. Light exposure and residual metal ions can also trigger oxidation of susceptible residues. Accelerated aging at elevated temperature is used to estimate shelf life, though extrapolation to room temperature carries uncertainty because individual degradation pathways do not always scale predictably.
Lyophilized semaglutide powder is typically held at minus twenty degrees Celsius for long-term storage. At that temperature, solid-state degradation reactions proceed slowly and the peptide remains intact for extended periods. Repeated freeze-thaw cycles are best avoided because they promote aggregation and can shift the proportion of monomeric peptide present. Working aliquots are often prepared so that each portion is thawed only once, and desiccant is placed inside the vial to limit moisture uptake.
Native GLP-1 is degraded rapidly by dipeptidyl peptidase-4. Semaglutide resists this cleavage because alanine at position 8 is replaced by alpha-aminoisobutyric acid. A second substitution at position 34 introduces arginine, which further stabilizes the peptide. The most distinctive modification is a spacer and C18 fatty diacid attached at lysine 26, enabling strong albumin affinity. These three changes together produce a half-life measured in days rather than minutes, and the same structural logic underlies other long-acting analogs in this class.
Semaglutide is a synthetic peptide analog of glucagon-like peptide-1, a hormone released from intestinal L-cells after food intake. It contains 31 amino acids and differs from native GLP-1 through modifications that slow enzymatic breakdown. The peptide was developed to extend the short circulating half-life of endogenous GLP-1, which is measured in minutes. Researchers introduced the compound in the early 2010s. Two backbone changes and a fatty acid side chain define its structure, distinguishing it from earlier GLP-1 receptor agonists.
The compound binds the GLP-1 receptor on pancreatic beta cells and other tissues, activating a G-protein signaling cascade that raises intracellular cyclic AMP. This action increases glucose-dependent insulin secretion when blood glucose is elevated, while binding also slows gastric emptying and reduces glucagon release. In the central nervous system, receptor activation in the hypothalamus and brainstem contributes to reduced appetite. The fatty acid chain binds albumin, which protects the peptide from renal filtration and enzymatic degradation. This albumin binding is central to its extended circulation time.
Semaglutide dissolves readily in water and in aqueous buffers near neutral pH. Solubility decreases near the isoelectric point, where net charge is minimal. Common laboratory solvents include phosphate-buffered saline and dilute ammonium bicarbonate. Strongly acidic or basic conditions may accelerate hydrolysis. Working concentrations are usually prepared by diluting a concentrated stock. Vial surfaces can adsorb small amounts of peptide at low concentrations, so carrier proteins or low-binding tubes are sometimes used.
Reverse-phase high-performance liquid chromatography is the standard method for purity assessment, separating the peptide from truncated or oxidized variants. Mass spectrometry confirms molecular mass and detects modifications, while ultraviolet absorbance near 280 nanometers supports concentration measurement through tryptophan and tyrosine residues. Circular dichroism can indicate secondary structure, though the peptide is largely helical in solution, and ion-exchange chromatography resolves charge variants. Purity values above 95 percent are typical for research-grade material. Stability studies track degradation over time under defined conditions.
Lyophilized semaglutide is typically stored at temperatures between minus 20 and minus 80 degrees Celsius for long-term preservation. Short-term storage at 2 to 8 degrees Celsius is common for working aliquots. Repeated freeze-thaw cycles can degrade the peptide and are usually avoided. The molecule is hygroscopic in its solid form, so containers should remain sealed with desiccant. Solutions are less stable than powders and are generally prepared fresh. Light exposure is limited because aromatic residues can undergo photo-oxidation.
== Theory == There are just 230 different ways of arranging objects in regular three-dimensional arrays. In molecular crystallography, these arrangements are called 'space groups'. However, only 65 of these arrangements are accessible to chiral objects or chiral molecules. The remaining 165 space groups contain either a center of symmetry or a mirror plane and are thus not accessible to natural globular proteins, which are chiral molecules. Wukowitz and Yeates developed a mathematical theory to explain the preference of globular proteins to crystallize in certain space groups. They suggested the preferred space group was determined by the number of degrees of freedom (D) or dimensionality as a measure of the ease with which a given symmetry can be formed. They analyzed the number of degrees of freedom for both chiral and achiral space groups where it was found that the space group P1(bar) with D=8 is theoretically the most dominant space group. Since the achiral space group had a higher degree of freedom compared to the chiral space groups, they predicted that racemic mixtures of protein enantiomers would crystallize more readily compared to the natural L-proteins alone by forming achiral {L-protein plus D-protein} pairs. While space group P1(bar) is most preferred, P21/c and C2/c are also highly preferred, whereas the other achiral space groups are expected to appear less frequently. Hence, P1(bar), P21/c, and C2/c are considered common centrosymmetric space groups in racemic mixtures.
=== International regulation === Under the framework of the Convention on Certain Conventional Weapons, states have discussed lethal autonomous weapon systems since 2014. In 2016, the treaty's states parties established an open-ended Group of Governmental Experts on Lethal Autonomous Weapons Systems to continue those discussions. The discussions have addressed international humanitarian law, accountability, possible prohibitions and regulations, and the extent of human control required over AI-enabled weapons.
There are many methods to investigate protein–protein interactions which are the physical contacts of high specificity established between two or more protein molecules. This process typically involves electrostatic forces and hydrophobic effects. Each of the approaches has its own strengths and weaknesses, especially with regard to the sensitivity and specificity of the method. A high sensitivity means that many of the interactions that occur are detected by the screen. A high specificity indicates that most of the interactions detected by the screen are occurring in reality.
=== Heredity === Hyperandrogenism can appear as a symptom of many different genetic and medical conditions. Some of the conditions with hyperandrogenic symptoms, including PMOS, may sometimes be hereditary. Additionally, it is thought that epigenetics may contribute to the pathogenesis of polyendocrine metabolic ovarian syndrome. One potential cause of PMOS is maternal hyperandrogenism, whereby hormonal irregularities in the mother can affect the development of the child during gestation, resulting in the passing of polyendocrine metabolic ovarian syndrome from mother to child. However, no androgen elevations were found in the umbilical cord blood of children born to mothers with PMOS.
=== EC 1.14.1 With NADH or NADPH as one donor (deleted sub-subclass) === EC 1.14.1.1: now EC 1.14.14.1, unspecific monooxygenase EC 1.14.1.2: now EC 1.14.13.9, kynurenine 3-monooxygenase EC 1.14.1.3: deleted, covered by EC 1.14.99.7, squalene monooxygenase and EC 5.4.99.7, lanosterol synthase EC 1.14.1.4: now EC 1.14.99.2, kynurenine 7,8-hydroxylase EC 1.14.1.5: now EC 1.14.13.5; imidazoleacetate 4-monooxygenase EC 1.14.1.6: now EC 1.14.15.4, steroid 11β-monooxygenase EC 1.14.1.7: now EC 1.14.99.9, steroid 17α-monooxygenase EC 1.14.1.8: now EC 1.14.99.10, steroid 21-monooxygenase EC 1.14.1.9: deleted EC 1.14.1.10: now EC 1.14.99.11 estradiol 6β-monooxygenase EC 1.14.1.11: deleted
Sources: en.wikipedia.org
It is now known that organic compounds can be conductors, semiconductors, and insulators, thus one of the main opportunities in nanomaterials science is to use organic synthesis and molecular design to make electronically useful structures. Structural motifs in these systems include colloids, small crystals, and aggregates on the order of 1-100 nm. By function Nanostructured materials can also be classed according to their functions, for example nanoelectronics and information technology (IT). Lateral dimensions used in information storage are shrinking from the micro- to the nanoscale as fabrication technologies improve. Optical materials are important in the development of miniaturized information storage because light has many advantages for storage and transmission over electronic methods. Quantum dots - most commonly CdSe nanoparticles having diameters of tens of nm, and with protective surface coatings - are notable for their ability to fluoresce over a broad range of the visible spectrum, with the controlling parameter being size. By structure Certain structural classes are especially relevant to nanoscience. As the dimensions of structures become smaller, their surface area-to-volume ratio increases. Much like molecules, nanostructures at small enough scales are essentially "all surface". The mechanical properties of materials are strongly influenced by these surface structures. Fracture strength and character, ductility, and various mechanical moduli all depend on the substructure of the materials over a range of scales.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
junk RNA Any RNA-encoded sequence, especially a transcript, that appears to have no known biological function, or whose function has no positive or a net negative effect on the fitness of the genome from which it is transcribed. Despite remaining untranslated, many non-coding RNAs still serve important functions, whereas junk RNAs are truly useless: often they are the product of accidental transcription of a junk DNA sequence, or they may result from post-transcriptional processing of primary transcripts, as with spliced-out introns. Junk RNA is usually quickly degraded by ribonucleases and other cytoplasmic enzymes.
Modified Adenine N6-carbamoyl-methyladenine N6-methyadenine Modified Guanine 7-Deazaguanine 7-Methylguanine Modified Cytosine N4-Methylcytosine 5-Carboxylcytosine 5-Formylcytosine 5-Glycosylhydroxymethylcytosine 5-Hydroxycytosine 5-Methylcytosine Modified Thymidine α-Glutamythymidine α-Putrescinylthymine Uracil and modifications Base J Uracil 5-Dihydroxypentauracil 5-Hydroxymethyldeoxyuracil Others Deoxyarchaeosine 2,6-Diaminopurine (2-Aminoadenine)
Production of the BG Familia mostly ended on 24 May 1994, although the 1.3 L hatchback was kept in production until October 1996 as there was originally no 1.3 L option in the following generation. In Australia and South America, the BG saloon continued to be sold until 1996 as a more affordable alternative to the newer BH model. The Indonesian market 323 was assembled locally starting in 1989 and was available only as a saloon. It was sold in a single trim called Interplay, powered by a carbureted 1.6 L SOHC engine mated to a 5-speed manual or a rare 4-speed automatic transmission. Unique to this market, the 323 came standard with a digital speedometer from the Eunos 100, a feature that was optional in Japan. Around late 1994, a special edition called Interplay Executive was introduced featuring the facelifted bumpers and bigger 14-inch steel wheels with hubcaps, but it also loses the digital speedometer. Also a few months later in this year when the newer BH model was introduced, BG model production was extended until 1997, primarily for the taxi fleet market. This fleet version had its premium features removed and an optional 1.3 L engine. In China, Haima—a joint venture between Hainan Auto Works and Mazda—began manufacturing the BG saloon on the island of Hainan in 1994. The saloon was initially marketed as the HMC6430, powered by a 1.3 L B3 engine. Another model, the GH7160, was released shortly thereafter with a 1.6 L SOHC B6 engine, manufactured at Haima's branch factory in Beihai, Guangxi.
Sources: en.wikipedia.org
=== Muscle and fat tissue === Microwave burns show some similarities with electrical burns, as the tissue damage is deep rather than superficial. Adipose tissue shows less degree of damage than muscles and other water-rich tissues. (In contrast, radiant heat, contact burns and chemical burns damage subcutaneous adipose tissue to higher extent than deeper muscle tissue.) Full-thickness biopsy of the area between burned and unburned skin shows layers of more and less damaged tissue (tissue sparing), layers of undamaged fat between damaged muscles; a pattern that is not present in conventional thermal or chemical burns. Cells subjected to electrical burns show microscopic nuclear streaming on histology examination; this feature is not present with microwave burns. Microwaves also deposit more energy to areas with low blood supply and to tissue interfaces. Hot spots may be formed in the tissue, with a consequent higher absorption of microwave energy and even higher temperature achieved, with localized necrosis of the affected tissue following. Sometimes, the affected tissue can even be charred. Muscle tissue destruction can lead to myoglobinuria, with renal failure following in severe cases; this is similar to burns from electric current. Urinalysis and serum CPK, BUN and creatine tests are used to check for this condition.
Up to the 20th century, alcoholic spirits were assessed in the UK by mixing with gunpowder and testing the mixture to see whether it would still burn; spirit that just passed the test was said to be at 100° proof. The UK now uses percentage alcohol by volume (ABV) at 20 °C (68.0 °F), where spirit at 100° proof is approximately 57.15% ABV. In the US, "proof number" is defined as twice the ABV at 60 °F (15.6 °C).
Although probably unrelated to AMPD deficiency, if the person happens to have a high load of d-lactate in the blood (mostly from food and colonic fermentation), the precipitate, the lactate loss and the magnesium loss may occur even before l-lactate (mostly from muscles) reaches its renal re-absorption threshold. This happens because l-lactate and d-lactate compete with each other for renal re-absorption, and because d-lactate has a significantly lower renal re-absorption threshold, <1 mmol/L. In order to keep the excreted metabolites in solution, the kidney also has to excrete water. This is in contrast to complete oxidation of lactic acid, which would actually yield metabolic water for the body. This may lead to onset of acute thirst some tens of minutes into exercise in this state, if the water balance in the body was neutral initially. If the muscle load is small, lactate is mostly recycled back into glucose or burned by other cells in the body. However the newly generated glucose is made available to all cells in the body, not just to muscle cells. The ability of the body to assimilate lactate may also be diminished, if working muscle cells cannot take up glucose from blood, due to myophosphorylase maintaining a higher concentration of it inside loaded cells, and if liver has already filled its glycogen stores up to capacity. So, ultimately, in this state, working muscle cells are destined to lose all glycogen. AMP breakdown to adenosine in this state is minor, because the pool of AMP is kept small by the vigorous regulatory action of myophosphorylase.
In March 2021, Grimstone finalized a deal between the UK and Mubadala, allowing it to oversee investment of around £10 billion in the UK from the UAE. A senior research officer at Transparency International UK, Rose Whiffen said if a minister is working for a firm and meeting its shareholder several times while in office, it should be declared or assessed before approval. A unit of the company, Mubadala Capital, invested €50 million in the Novalpina Capital private equity fund of €1 billion, which bought the Israeli security company NSO Group in 2019. Reports revealed that the UAE targeted human rights activists, journalists, and Princess Haya using the Pegasus spyware, during the same time. Mubadala Capital got a seat on Novalpina's committee of largest investors. In 2021, Mubadala invested in wefox, a German digital insurance platform, through a $650 million funding round and led another $400 million round in 2022. In May 2022, Mubadala Investment Company signed a preliminary agreement with French utility Engie for the development of a digital platform to charge electric vehicles in the UAE and across the Middle East. The two companies would also explore areas related to sustainable mobility. In 2022, Mubadala sold the Anglo-Trade Bank, which it funded together with AGTB Holdings in 2018, to Gulf Islamic Investments. In April 2023 Mubadala, together with Stone Point Capital and other partners, acquired 20% of Truist Insurance Holdings for $1.95 billion.
=== Safety === Like for other radioactive imaging agents in medicine, the applied amounts of radioactivity are so low that radiation-related adverse effects are very unlikely to occur, and have not been observed in practice. Consistent with the "tracer principle", the amount of pharmacologically active compound injected to a patient in the course of such an examination is extremely low. Adverse events, such as toxicity or allergic reactions, are thus highly improbable. No adverse or clinically detectable pharmacologic effects were observed following intravenous administration of 68Ga-Trivehexin when administered to cancer patients, and there were no significant changes in vital signs, laboratory study results, or electrocardiograms. In a study involving healthy volunteers, researchers again reported no adverse or clinically detectable pharmacologic effects and no significant changes in vital signs.
Sources: en.wikipedia.org
Filtering removes particulate matter that can block columns or scatter light. A 0.22 micrometre membrane is typical, and the filter material should be checked for peptide adsorption.
Peptides can bind to glass and plastic, so a fraction of the material leaves the solution. The effect is proportionally larger in dilute samples and can bias quantitative results.
Reverse-phase high-performance liquid chromatography is the most widely reported approach. Purity figures should always be quoted together with the wavelength, gradient, and integration parameters used.
Native GLP-1 is degraded within minutes by circulating enzymes. The synthetic version carries substitutions at positions that block enzymatic cleavage, plus a fatty acid side chain that promotes albumin binding. These two changes together extend circulation time from minutes to roughly a week.